PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01519.2.p
Common NameEUGRSUZ_I01519, LOC104419030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 927aa    MW: 103674 Da    PI: 6.7106
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01519.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.28e-29597647252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek+isl++l++yF++++kdAA+++gvc+T+LKriCRq+GI RWP+Rkik++
  Eucgr.I01519.2.p 597 EKTISLDVLRQYFAGSLKDAARSIGVCPTTLKRICRQHGITRWPSRKIKKV 647
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.257584667IPR003035RWP-RK domain
PfamPF020421.8E-24599647IPR003035RWP-RK domain
SMARTSM006661.1E-26820903IPR000270PB1 domain
PROSITE profilePS5174527.047820903IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.9E-23821902No hitNo description
PfamPF005641.5E-16821902IPR000270PB1 domain
SuperFamilySSF542776.17E-22821902No hitNo description
CDDcd064077.95E-43822902No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MEDVAFTPNF TSESLLDSAM DLDLMDQLLL EGCWLETTDA SNYPFRGIFQ EEAGKDFAES  60
PPSTCPRIEE RLEMEQKNIN PFEATASSSQ SEGFQIEGTE VGRRCWIAPT ANPGPSSSMK  120
QRLMMVLGRL KECTKDKDVL VQIWVPVKKG GRNVLTTIDQ PYVYNPNSKS LESYRNVSKT  180
YQFLADEETK ESVGLPGRVF LGKLPEWTPD VRFFSSEEYP RRDYAQQYDV RGSLALPVFE  240
RGSGTCLGVV EIITTSQKIN YRPELETVCK ALEAVDLRSS QTFRPPSAKA CNQSHQAALP  300
QILEVLTSVC RQYRLPLALT WASCLQQGKE GPRHSNENYE FCVSTVDSAC FVADQHYLGF  360
QEACSEHHLL RGQGIVGRAF TINQPCFAAD ITAFSRKEYP LAHHARMLGL CCATAIPLAS  420
IHTGSVDFVL EFFLPRDCRD AEEQKQMINS LSSFVCQTLQ NSQKEQKETL VSSTRYTGVN  480
TSDKRIQAEE TDKLLPSLNK RHPQEVSWIA NMVEAQKNSK GISVPFEVQK EPKEEFTVTT  540
KWEETEIGLQ HGQFHPEFHR VQQNLENKPN VEGGDTLGQF PSIGGRKSGQ RTRTKTEKTI  600
SLDVLRQYFA GSLKDAARSI GVCPTTLKRI CRQHGITRWP SRKIKKVGHS LKKLESIINS  660
VQGAEGTIRI RSFYESFPEL NSPRHSEKGT FSSANLGNPL EQLNPQTENG LFSSGATTSN  720
SPSSSCSQSS GSTTSFSTGT KQCFTAITAL SSGDPVMSNN PSEVLKRTRS DAELHISTHE  780
EPKPLIRSQS HKSLDEWGSL ENVATLPKTN SPRITRDLGI YRIKAILGEE KIRFSLKPSW  840
GLRDLQREVA NRFNIEDIGT IDLKYLDDDQ EWVLLTCDAD LEECIDVYRM SRNHTIRISI  900
HQSSHQNLSS LGGSSGEAQH RGHIHL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01519.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028835.10.0PREDICTED: protein NLP2-like
RefseqXP_010028836.10.0PREDICTED: protein NLP2-like
RefseqXP_010028837.10.0PREDICTED: protein NLP2-like
RefseqXP_010028838.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A059APP70.0A0A059APP7_EUCGR; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein